McDonnell Genome Institute

Washington University

Transcript

MIR3936HG:16

Chromosome

chr5

Gene Name

MIR3936HG

Start

132364221

CPC Label

noncoding

End

132369648

Cancer

OV

Strand

-

Peptide

AYLGAER

Modified Peptide

n[145]AYLGAER

Peptide Length

7

ORF Length

92

Open Reading Frame (ORF)

LARPGLCQPSLLGTTEVARARLRKAAGLEALGSESELAPLAPGGERVGERPRSSSVENAPLPAFCKAYLGAERQASCHVISSPLRGPCDVKE

Conservation Score

0.025

PhyloCSF Frame 1

-1.425

No. of Spectra

3

CPC Coding Probability

0.0449187

PhyloCSF Frame 2 

-3.801

CNTI Index

noncoding

Max Probability

0.7982

PhyloCSF Frame 3

-4.359

CNTI Score

-0.342589588