McDonnell Genome Institute

Washington University

Transcript

MIR3681HG:34

Chromosome

chr2

Gene Name

MIR3681HG

Start

12326913

CPC Label

noncoding

End

12327294

Cancer

OSCC

Strand

+

Peptide

FDSAYLRPGTDSLR

Modified Peptide

n[145]FDSAYLRPGTDSLR

Peptide Length

14

ORF Length

64

Open Reading Frame (ORF)

LNELGMAPPSGSKDGGGKGTWRGEQGKFDSAYLRPGTDSLRSSEQWQRRAPLFSPAGCSQLCLE

Conservation Score

0.114

PhyloCSF Frame 1

-5.542

No. of Spectra

5

CPC Coding Probability

0.0709589

PhyloCSF Frame 2 

-4.656

CNTI Index

noncoding

Max Probability

0.6185

PhyloCSF Frame 3

-4.469

CNTI Score

-0.36812552