McDonnell Genome Institute

Washington University

Transcript

MIR3681HG:27

Chromosome

chr2

Gene Name

MIR3681HG

Start

12277765

CPC Label

noncoding

End

12598651

Cancer

CCRC

Strand

+

Peptide

FLGGIDK

Modified Peptide

n[230]FLGGIDK

Peptide Length

7

ORF Length

60

Open Reading Frame (ORF)

LRLRFLGGIDKATWLGNTGAGPCSQVHLVPGCLFSQLTHMMSPRRNEKYPLSSVASVLLN

Conservation Score

0.037

PhyloCSF Frame 1

-3.915

No. of Spectra

5

CPC Coding Probability

0.465781

PhyloCSF Frame 2 

-4.257

CNTI Index

noncoding

Max Probability

0.9954

PhyloCSF Frame 3

-5.406

CNTI Score

-0.354289921