McDonnell Genome Institute

Washington University

Transcript

MIR3681HG:26

Chromosome

chr2

Gene Name

MIR3681HG

Start

12277765

CPC Label

coding

End

12332377

Cancer

LUAD

Strand

+

Peptide

ISQFLER

Modified Peptide

n[230]ISQFLER

Peptide Length

7

ORF Length

38

Open Reading Frame (ORF)

LFLMRISQFLERGKSSPCSATHFQILCSALGWRVSNLM

Conservation Score

1

PhyloCSF Frame 1

-5.43

No. of Spectra

18

CPC Coding Probability

0.964623

PhyloCSF Frame 2 

-4.284

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

-2.07

CNTI Score

-0.311913956