McDonnell Genome Institute

Washington University

Transcript

MIR3663HG:4

Chromosome

chr10

Gene Name

MIR3663HG

Start

117153552

CPC Label

noncoding

End

117169047

Cancer

CCRC

Strand

-

Peptide

ERPCEDIRR

Modified Peptide

ERPCEDIRR

Peptide Length

9

ORF Length

75

Open Reading Frame (ORF)

LLKYTKGVPAAILVFPRPVSAPSRENLEWEGKWQPSGNEMLAQRILSKSITSPKERPCEDIRRRQPSISQEESPH

Conservation Score

1

PhyloCSF Frame 1

-3.093

No. of Spectra

1

CPC Coding Probability

0.0125741

PhyloCSF Frame 2 

-4.858

CNTI Index

noncoding

Max Probability

0.4288

PhyloCSF Frame 3

-3.155

CNTI Score

-0.403061408