McDonnell Genome Institute

Washington University

Transcript

MIR3663HG:2

Chromosome

chr10

Gene Name

MIR3663HG

Start

117158655

CPC Label

noncoding

End

117169055

Cancer

OV

Strand

-

Peptide

GQMASGTQGNLTLEEMEK

Modified Peptide

n[145]GQMASGTQGNLTLEEMEK

Peptide Length

18

ORF Length

55

Open Reading Frame (ORF)

LKRPQRGFPPNSGLEEPSLSIPSASGVCFTHRRGQMASGTQGNLTLEEMEKLERH

Conservation Score

0.191

PhyloCSF Frame 1

-4.975

No. of Spectra

1

CPC Coding Probability

0.0324895

PhyloCSF Frame 2 

-3.479

CNTI Index

noncoding

Max Probability

0.9139

PhyloCSF Frame 3

-4.763

CNTI Score

-0.360665407