McDonnell Genome Institute

Washington University

Transcript

MIR34AHG:17

Chromosome

chr1

Gene Name

MIR34AHG

Start

9148010

CPC Label

noncoding

End

9182392

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

LTEAALR

Modified Peptide

n[145]LTEAALR

Peptide Length

7

ORF Length

35

Open Reading Frame (ORF)

LTEAALRTASEQKSTPFSPVLGRSKECLYLLPTSN

Conservation Score

1

PhyloCSF Frame 1

-2.327

No. of Spectra

10

CPC Coding Probability

0.438432

PhyloCSF Frame 2 

-4.114

CNTI Index

noncoding

Max Probability

0.9964

PhyloCSF Frame 3

-2.778

CNTI Score

-0.314505846