McDonnell Genome Institute

Washington University

Transcript

MIR34AHG:11

Chromosome

chr1

Gene Name

MIR34AHG

Start

9168267

CPC Label

noncoding

End

9202619

Cancer

BRCA-Luminal A

Strand

-

Peptide

AQFGVLQTVEEMPLSR

Modified Peptide

n[145]AQFGVLQTVEEM[147]PLSR

Peptide Length

16

ORF Length

130

Open Reading Frame (ORF)

LPRESKENPPFRFAQVEISRAQFGVLQTVEEMPLSRRSGDSPAPRIPGWRDASRPRGLVARAGRRTRRRALPGLAWACSEPGCFSVTTQIGGIWRFCGSPAAKLRGRRGLEACTTCSPRPSMHPGWSTVV

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

69

CPC Coding Probability

0.0957545

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

0

CNTI Score

-0.29798821