McDonnell Genome Institute

Washington University

Transcript

MIR31HG:9

Chromosome

chr9

Gene Name

MIR31HG

Start

21445502

CPC Label

noncoding

End

21591766

Cancer

CCRC

Strand

-

Peptide

SFWSSYR

Modified Peptide

n[230]SFWSSYR

Peptide Length

7

ORF Length

35

Open Reading Frame (ORF)

LHNRETGVSSKVNSSRDILSYMRSKSFWSSYRVVE

Conservation Score

0.979

PhyloCSF Frame 1

-5.611

No. of Spectra

1

CPC Coding Probability

0.300216

PhyloCSF Frame 2 

-5.415

CNTI Index

noncoding

Max Probability

0.7947

PhyloCSF Frame 3

-3.899

CNTI Score

-0.334519503