McDonnell Genome Institute

Washington University

Transcript

MIR31HG:6

Chromosome

chr9

Gene Name

MIR31HG

Start

21507769

CPC Label

noncoding

End

21591905

Cancer

OV

Strand

-

Peptide

ITGLQGTLKPNPRK

Modified Peptide

n[145]ITGLQGTLKPNPRK

Peptide Length

14

ORF Length

45

Open Reading Frame (ORF)

LNWAEIAEMTEIKFKIWIGTKITGLQGTLKPNPRKLRITVKQCRS

Conservation Score

0.84

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.290361

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7717

PhyloCSF Frame 3

0

CNTI Score

-0.323662008