McDonnell Genome Institute

Washington University

Transcript

MIR3150BHG:6

Chromosome

chr8

Gene Name

MIR3150BHG

Start

95066807

CPC Label

noncoding

End

95072920

Cancer

HCC

Strand

-

Peptide

LNLVFGAEK

Modified Peptide

n[230]LNLVFGAEK

Peptide Length

9

ORF Length

44

Open Reading Frame (ORF)

LNLVFGAEKKGSCRKEIGVEPHLHRNYGVIRTPGRKFGNEWKER

Conservation Score

0.79

PhyloCSF Frame 1

-1.882

No. of Spectra

1

CPC Coding Probability

0.111621

PhyloCSF Frame 2 

-4.805

CNTI Index

noncoding

Max Probability

0.4533

PhyloCSF Frame 3

-5.082

CNTI Score

-0.353667925