McDonnell Genome Institute

Washington University

Transcript

MIR29B2CHG:92

Chromosome

chr1

Gene Name

MIR29B2CHG

Start

207805325

CPC Label

noncoding

End

207807536

Cancer

OV

Strand

-

Peptide

LSLGFMSVVLR

Modified Peptide

n[145]LSLGFM[147]SVVLR

Peptide Length

11

ORF Length

45

Open Reading Frame (ORF)

LSLGFMSVVLREGWKTELLGVQLPRNIDLHTSDAGETRKTDAGST

Conservation Score

0.033

PhyloCSF Frame 1

-5.365

No. of Spectra

1

CPC Coding Probability

0.164516

PhyloCSF Frame 2 

-4.22

CNTI Index

noncoding

Max Probability

0.1621

PhyloCSF Frame 3

-3.518

CNTI Score

-0.357029775