McDonnell Genome Institute

Washington University

Transcript

MIR29B2CHG:81

Chromosome

chr1

Gene Name

MIR29B2CHG

Start

207795490

CPC Label

noncoding

End

207823912

Cancer

OV

Strand

-

Peptide

LFLIGSGQGIK

Modified Peptide

n[145]LFLIGSGQGIK

Peptide Length

11

ORF Length

56

Open Reading Frame (ORF)

LVGGPMAGEKLFLIGSGQGIKSEFAFHLLKGERGEAQQLSKISLGVCVGSCVYACF

Conservation Score

1

PhyloCSF Frame 1

-2.918

No. of Spectra

1

CPC Coding Probability

0.236428

PhyloCSF Frame 2 

-2.024

CNTI Index

noncoding

Max Probability

0.4934

PhyloCSF Frame 3

1.326

CNTI Score

-0.325047433