McDonnell Genome Institute

Washington University

Transcript

MIR29B2CHG:61

Chromosome

chr1

Gene Name

MIR29B2CHG

Start

207801517

CPC Label

noncoding

End

207869150

Cancer

EOGC

Strand

-

Peptide

LLLCTEPLLCAR

Modified Peptide

n[145]LLLCTEPLLCAR

Peptide Length

12

ORF Length

35

Open Reading Frame (ORF)

MPFGSHGQAELSKASTWRLLLCTEPLLCARDCARR

Conservation Score

0.017

PhyloCSF Frame 1

-3.257

No. of Spectra

28

CPC Coding Probability

0.243625

PhyloCSF Frame 2 

-4.424

CNTI Index

noncoding

Max Probability

0.9975

PhyloCSF Frame 3

-4.121

CNTI Score

-0.299892843