McDonnell Genome Institute

Washington University

Transcript

MIR29B2CHG:57

Chromosome

chr1

Gene Name

MIR29B2CHG

Start

207818375

CPC Label

coding

End

207869166

Cancer

OSCC

Strand

-

Peptide

LGDGYLGVYYTVLSHFTYVR

Modified Peptide

n[145]LGDGYLGVYYTVLSHFTYVR

Peptide Length

20

ORF Length

107

Open Reading Frame (ORF)

LLKLGDGYLGVYYTVLSHFTYVRNCLSFFFFFFFFEESRSVAQAGVRWHNLGSLQAPPPGFTPFSCLSLPSSWDYRCLPPRPANFFVFLIETEFHRVSQDGLDLLTS

Conservation Score

0.124

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.962996

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5561

PhyloCSF Frame 3

0

CNTI Score

-0.284115066