McDonnell Genome Institute

Washington University

Transcript

MIR22HG:54

Chromosome

chr17

Gene Name

MIR22HG

Start

1710719

CPC Label

noncoding

End

1714450

Cancer

OV

Strand

-

Peptide

GVETSGGR

Modified Peptide

n[145]GVETSGGR

Peptide Length

8

ORF Length

89

Open Reading Frame (ORF)

MLGVGAGPSGSLLQHGVSWGLWGRGSRTAGITGLPGYGKGVETSGGRRGGSKKVGHPVPTTDAGREVGAAARLGQVRVGCASLCLAGCG

Conservation Score

0.041

PhyloCSF Frame 1

-4.566

No. of Spectra

1

CPC Coding Probability

0.171972

PhyloCSF Frame 2 

-4.765

CNTI Index

noncoding

Max Probability

0.6342

PhyloCSF Frame 3

-5.396

CNTI Score

-0.324900346