McDonnell Genome Institute

Washington University

Transcript

MIR217HG:3

Chromosome

chr2

Gene Name

MIR217HG

Start

55956591

CPC Label

noncoding

End

55989708

Cancer

OV

Strand

-

Peptide

GTVNLGK

Modified Peptide

n[145]GTVNLGK

Peptide Length

7

ORF Length

64

Open Reading Frame (ORF)

LKKDLDTLPKINNISLSLPQRDPWPFTKGTVNLGKGNNQIFRELPDIGSELTLIPGDPKVTVAH

Conservation Score

0.98

PhyloCSF Frame 1

-4.687

No. of Spectra

4

CPC Coding Probability

0.473597

PhyloCSF Frame 2 

-5.418

CNTI Index

noncoding

Max Probability

0.7009

PhyloCSF Frame 3

-5.092

CNTI Score

-0.339413658