McDonnell Genome Institute

Washington University

Transcript

MIR210HG:2

Chromosome

chr11

Gene Name

MIR210HG

Start

565534

CPC Label

coding

End

568457

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

VGVSEIIR

Modified Peptide

n[145]VGVSEIIR

Peptide Length

8

ORF Length

201

Open Reading Frame (ORF)

LDTVGRGCPMDGVCLSGQQGRRVGVSEIIRGLCCPPLGGAEAGPDTLLEGTFFSLCVQGTSVRSSCCQAEGGPGQAQVWSYLQPTGPSSGGPPLGTSYGKRVTDLVLLCVSAASVGPLRETAGGSSSSLSAEPAFSSLLLKSGPGRVRAYRPCLRSPGLQELRAAPARWRGRGRFSGRLAWTRTGLWKLPALTGLPVTTAK

Conservation Score

0.976

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.569558

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8731

PhyloCSF Frame 3

0

CNTI Score

-0.306601626