McDonnell Genome Institute

Washington University

Transcript

MIR205HG:14

Chromosome

chr1

Gene Name

MIR205HG

Start

209427529

CPC Label

noncoding

End

209433438

Cancer

OSCC

Strand

+

Peptide

LSGSMIR

Modified Peptide

n[145]LSGSMIR

Peptide Length

7

ORF Length

77

Open Reading Frame (ORF)

LSGSMIRFDRFSTDFILFTIQCDWVCVCVCVCVCVCVCVTPCFSFLRKEKVWNKRKFLSLKEVQPSYEGNAIHKPFL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

13

CPC Coding Probability

0.279179

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9027

PhyloCSF Frame 3

0

CNTI Score

-0.416824143