McDonnell Genome Institute

Washington University

Transcript

MIR2052HG:3

Chromosome

chr8

Gene Name

MIR2052HG

Start

74599865

CPC Label

noncoding

End

74758352

Cancer

OV

Strand

+

Peptide

LGGMFWSDLSFSSGAR

Modified Peptide

n[145]LGGM[147]FWSDLSFSSGAR

Peptide Length

16

ORF Length

101

Open Reading Frame (ORF)

MIQRQRWQLWSKWRARKGSRTGVEAEAMPSFMSDEAVSSDLKMMKKSSLQGCLLNITGKTGKLGGMFWSDLSFSSGARVQSSHQINTFSKLINFGEATQSS

Conservation Score

1

PhyloCSF Frame 1

-4.812

No. of Spectra

1

CPC Coding Probability

0.197631

PhyloCSF Frame 2 

-4.059

CNTI Index

noncoding

Max Probability

0.1311

PhyloCSF Frame 3

-4.937

CNTI Score

-0.386831722