McDonnell Genome Institute

Washington University

Transcript

MIR2052HG:1

Chromosome

chr8

Gene Name

MIR2052HG

Start

74599774

CPC Label

noncoding

End

74703679

Cancer

EOGC

Strand

+

Peptide

VAALEQVESQK

Modified Peptide

n[145]VAALEQVESQK

Peptide Length

11

ORF Length

69

Open Reading Frame (ORF)

MAGAPPPASLPPCSLISDCCASNQRDSVGVGPSEPVPERSHDPETKVAALEQVESQKRIQNWSGRTAAL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

45

CPC Coding Probability

0.119043

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9981

PhyloCSF Frame 3

0

CNTI Score

-0.358008225