McDonnell Genome Institute

Washington University

Transcript

MIR194-2HG:6

Chromosome

chr11

Gene Name

MIR194-2HG

Start

64882820

CPC Label

noncoding

End

64893448

Cancer

OV

Strand

-

Peptide

LDSHGVAGTSPFLSVPWFPLWDK

Modified Peptide

n[145]LDSHGVAGTSPFLSVPWFPLWDK

Peptide Length

23

ORF Length

104

Open Reading Frame (ORF)

LDSHGVAGTSPFLSVPWFPLWDKGALASALRAVEPGFLIGRCLCQARALGHHAAGGWSRPGLCGKGRQAEWRASHQLRCLPSQVCPPRQKDSSPGIPHPTLTAS

Conservation Score

0.04

PhyloCSF Frame 1

-2.873

No. of Spectra

1

CPC Coding Probability

0.350896

PhyloCSF Frame 2 

-3.001

CNTI Index

noncoding

Max Probability

0.779

PhyloCSF Frame 3

-3.968

CNTI Score

-0.308065026