McDonnell Genome Institute

Washington University

Transcript

MIR193BHG:26

Chromosome

chr16

Gene Name

MIR193BHG

Start

14311756

CPC Label

noncoding

End

14317130

Cancer

OSCC

Strand

+

Peptide

DLEAASVEHIK

Modified Peptide

n[145]DLEAASVEHIK

Peptide Length

11

ORF Length

45

Open Reading Frame (ORF)

LGRTEDGETGLGVGAGGWCWRDLEAASVEHIKEPYFGVPFSEPQQ

Conservation Score

0.429

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0297616

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9899

PhyloCSF Frame 3

0

CNTI Score

-0.344064506