McDonnell Genome Institute

Washington University

Transcript

MIR193BHG:18

Chromosome

chr16

Gene Name

MIR193BHG

Start

14302243

CPC Label

noncoding

End

14336038

Cancer

HCC

Strand

+

Peptide

GHATGAK

Modified Peptide

n[230]GHATGAK

Peptide Length

7

ORF Length

67

Open Reading Frame (ORF)

LGPSCRLSHGKGRIAPSQTWPRWPGAHWYRCPESLPELRGHATGAKEPASDWGVGSVWGCLFTPFSI

Conservation Score

0.995

PhyloCSF Frame 1

-3.176

No. of Spectra

6

CPC Coding Probability

0.213791

PhyloCSF Frame 2 

-2.687

CNTI Index

noncoding

Max Probability

0.9979

PhyloCSF Frame 3

-4.357

CNTI Score

-0.29346141