McDonnell Genome Institute

Washington University

Transcript

MIR193BHG:15

Chromosome

chr16

Gene Name

MIR193BHG

Start

14301383

CPC Label

noncoding

End

14336038

Cancer

OSCC

Strand

+

Peptide

MPQQGQEISAAR

Modified Peptide

n[145]MPQQGQEISAAR

Peptide Length

12

ORF Length

34

Open Reading Frame (ORF)

MPQQGQEISAARRLKSSPDHFPNEETVAQRSQVT

Conservation Score

0.943

PhyloCSF Frame 1

-5.45

No. of Spectra

1

CPC Coding Probability

0.114095

PhyloCSF Frame 2 

-4.741

CNTI Index

noncoding

Max Probability

0.5423

PhyloCSF Frame 3

-4.827

CNTI Score

-0.32200154