McDonnell Genome Institute

Washington University

Transcript

MIR17HG:13

Chromosome

chr13

Gene Name

MIR17HG

Start

91347686

CPC Label

noncoding

End

91360201

Cancer

OSCC

Strand

+

Peptide

AGRPHPRPGASGRSK

Modified Peptide

n[145]AGRPHPRPGASGRSK

Peptide Length

15

ORF Length

88

Open Reading Frame (ORF)

MVLRGAAAAARPAPSRHFAPSGEAEGVGTTTAAPPGLALLREALLAGRAGRPHPRPGASGRSKAQAGGEAGAGARGRPAEDGGGYSSW

Conservation Score

1

PhyloCSF Frame 1

4.558

No. of Spectra

8

CPC Coding Probability

0.216464

PhyloCSF Frame 2 

0.938

CNTI Index

coding

Max Probability

0.8362

PhyloCSF Frame 3

0.783

CNTI Score

0.775165067