McDonnell Genome Institute

Washington University

Transcript

MIR155HG:8

Chromosome

chr21

Gene Name

MIR155HG

Start

25562130

CPC Label

noncoding

End

25575086

Cancer

BRCA-Luminal B

Strand

+

Peptide

VTAGLTGEAR

Modified Peptide

n[145]VTAGLTGEAR

Peptide Length

10

ORF Length

131

Open Reading Frame (ORF)

LCAAEPGPSAACSLGKGADSGAPSRPQSKRGEPRRRSWHCRYADFSLALPPAFPLLNVAGTPGDFGARVTAGLTGEARRGQRARGRGARPGPARACGCPLGTQWCRLARDQRLRWMDSRGQRQGEGGVFET

Conservation Score

1

PhyloCSF Frame 1

-0.687

No. of Spectra

3

CPC Coding Probability

0.0257215

PhyloCSF Frame 2 

-0.628

CNTI Index

coding

Max Probability

0.9783

PhyloCSF Frame 3

-1.425

CNTI Score

0.696585178