McDonnell Genome Institute

Washington University

Transcript

MIR137HG:1

Chromosome

chr1

Gene Name

MIR137HG

Start

97975281

CPC Label

noncoding

End

98049863

Cancer

OV

Strand

-

Peptide

NIVVCRERVEPFSEAPGGESILR

Modified Peptide

n[145]NIVVCRERVEPFSEAPGGESILR

Peptide Length

23

ORF Length

53

Open Reading Frame (ORF)

LPTPNPTPLCLIPQLLPGYLYSQLLRSKNIVVCRERVEPFSEAPGGESILRMS

Conservation Score

0.996

PhyloCSF Frame 1

-3.981

No. of Spectra

13

CPC Coding Probability

0.114618

PhyloCSF Frame 2 

-3.527

CNTI Index

coding

Max Probability

0.8334

PhyloCSF Frame 3

-5.12

CNTI Score

0.654995161