McDonnell Genome Institute

Washington University

Transcript

MIR133A1HG:2

Chromosome

chr18

Gene Name

MIR133A1HG

Start

21825486

CPC Label

noncoding

End

21831406

Cancer

PRAD

Strand

-

Peptide

MLTLSNAVLFFSHGLSLPR

Modified Peptide

Peptide Length

19

ORF Length

39

Open Reading Frame (ORF)

MLTLSNAVLFFSHGLSLPRYGQYMKLNCHPKTHLSNWIC

Conservation Score

1

PhyloCSF Frame 1

-4.329

No. of Spectra

3

CPC Coding Probability

0.0584206

PhyloCSF Frame 2 

-1.595

CNTI Index

noncoding

Max Probability

0.5427

PhyloCSF Frame 3

-2.498

CNTI Score

-0.374363646