McDonnell Genome Institute

Washington University

Transcript

MIR124-2HG:20

Chromosome

chr8

Gene Name

MIR124-2HG

Start

64373793

CPC Label

noncoding

End

64402513

Cancer

OV

Strand

+

Peptide

HIFMHFCLTTHTGAFMTR

Modified Peptide

n[145]HIFMHFCLTTHTGAFMTR

Peptide Length

18

ORF Length

45

Open Reading Frame (ORF)

MHIFMHFCLTTHTGAFMTRYLGVVPTSKQCRCEHNINSQTESNSY

Conservation Score

0.169

PhyloCSF Frame 1

-5.988

No. of Spectra

6

CPC Coding Probability

0.0985495

PhyloCSF Frame 2 

-5.477

CNTI Index

coding

Max Probability

0.9124

PhyloCSF Frame 3

-4.061

CNTI Score

0.663190881