McDonnell Genome Institute

Washington University

Transcript

MIR122HG:14

Chromosome

chr18

Gene Name

MIR122HG

Start

58446274

CPC Label

noncoding

End

58453766

Cancer

OSCC

Strand

+

Peptide

LFSQVNK

Modified Peptide

n[145]LFSQVNK

Peptide Length

7

ORF Length

44

Open Reading Frame (ORF)

LFSQVNKKIADQARWLTPEIPALWEAKAGGSLELRSSSPAWAAW

Conservation Score

0.196

PhyloCSF Frame 1

-4.809

No. of Spectra

10

CPC Coding Probability

0.110729

PhyloCSF Frame 2 

-5.136

CNTI Index

noncoding

Max Probability

0.5795

PhyloCSF Frame 3

-3.524

CNTI Score

-0.360222545