McDonnell Genome Institute

Washington University

Transcript

MIR100HG:34

Chromosome

chr11

Gene Name

MIR100HG

Start

122038236

CPC Label

noncoding

End

122066432

Cancer

OV

Strand

-

Peptide

GGAYAQK

Modified Peptide

n[145]GGAYAQK

Peptide Length

7

ORF Length

57

Open Reading Frame (ORF)

LDKGGAYAQKQDYLKEKRKGENTQRYSRGGHMKMEAETGVMSLQAKECQGLPAAMRS

Conservation Score

0.074

PhyloCSF Frame 1

-5.619

No. of Spectra

1

CPC Coding Probability

0.00655553

PhyloCSF Frame 2 

-4.236

CNTI Index

noncoding

Max Probability

0.9914

PhyloCSF Frame 3

-4.611

CNTI Score

-0.346882711