McDonnell Genome Institute

Washington University

Transcript

MIR100HG:2

Chromosome

chr11

Gene Name

MIR100HG

Start

122180337

CPC Label

noncoding

End

122367973

Cancer

OV

Strand

-

Peptide

LGTEDYLGK

Modified Peptide

n[145]LGTEDYLGK

Peptide Length

9

ORF Length

55

Open Reading Frame (ORF)

LGTEDYLGKDGLSGKLDSAWSMFPRLLFCEGFRIQMTQIQTFKNDLGGPSGSCWF

Conservation Score

1

PhyloCSF Frame 1

-2.709

No. of Spectra

4

CPC Coding Probability

0.0122075

PhyloCSF Frame 2 

-2.634

CNTI Index

noncoding

Max Probability

0.9424

PhyloCSF Frame 3

-3.097

CNTI Score

-0.420844491