McDonnell Genome Institute

Washington University

Transcript

MIR100HG:17

Chromosome

chr11

Gene Name

MIR100HG

Start

122089102

CPC Label

noncoding

End

122102178

Cancer

EOGC

Strand

-

Peptide

YLIFDNGK

Modified Peptide

n[145]YLIFDNGK

Peptide Length

8

ORF Length

42

Open Reading Frame (ORF)

LNNRGLRHNSFSKESAKLGLLMDKHLNVWKYLIFDNGKFPLS

Conservation Score

0.4

PhyloCSF Frame 1

-5.822

No. of Spectra

109

CPC Coding Probability

0.0599146

PhyloCSF Frame 2 

-5.144

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

-4.054

CNTI Score

-0.376841838