McDonnell Genome Institute

Washington University

Transcript

MIR1-1HG-AS1:41

Chromosome

chr20

Gene Name

MIR1-1HG-AS1

Start

62544546

CPC Label

noncoding

End

62551524

Cancer

OV

Strand

-

Peptide

LGVDPSWLGAMNPLTTVSSHEIWLLR

Modified Peptide

n[145]LGVDPSWLGAMNPLTTVSSHEIWLLR

Peptide Length

26

ORF Length

44

Open Reading Frame (ORF)

LGVDPSWLGAMNPLTTVSSHEIWLLRSVSYLPHNSLSFVPALAM

Conservation Score

0.067

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.191769

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8718

PhyloCSF Frame 3

0

CNTI Score

-0.268284481