McDonnell Genome Institute

Washington University

Transcript

MIR1-1HG-AS1:32

Chromosome

chr20

Gene Name

MIR1-1HG-AS1

Start

62544342

CPC Label

noncoding

End

62551526

Cancer

OV

Strand

-

Peptide

AEGGASPVPAPSITVPR

Modified Peptide

n[145]AEGGASPVPAPSITVPR

Peptide Length

17

ORF Length

58

Open Reading Frame (ORF)

LSRGGPCHPQFLGIPAPAGRAEGGASPVPAPSITVPRWRGRPFRAWAWVWMRAGLSPL

Conservation Score

0.067

PhyloCSF Frame 1

-4.094

No. of Spectra

1

CPC Coding Probability

0.144945

PhyloCSF Frame 2 

-4.513

CNTI Index

noncoding

Max Probability

0.9623

PhyloCSF Frame 3

-3.478

CNTI Score

-0.259260471