McDonnell Genome Institute

Washington University

Transcript

MIR1-1HG-AS1:3

Chromosome

chr20

Gene Name

MIR1-1HG-AS1

Start

62543069

CPC Label

noncoding

End

62551561

Cancer

OV

Strand

-

Peptide

FISLLGLQENK

Modified Peptide

n[145]FISLLGLQENK

Peptide Length

11

ORF Length

80

Open Reading Frame (ORF)

LWAQCPHRVLRRGGGRVRVRGSLEDIAQMALKEGPRVKAREPPDPGEGRTRILPRASSSQPFQHMDFRFISLLGLQENKL

Conservation Score

0.023

PhyloCSF Frame 1

-3.953

No. of Spectra

2

CPC Coding Probability

0.129801

PhyloCSF Frame 2 

-4.303

CNTI Index

noncoding

Max Probability

0.8138

PhyloCSF Frame 3

-4.679

CNTI Score

-0.259260471