McDonnell Genome Institute

Washington University

Transcript

MINCR:1

Chromosome

chr8

Gene Name

MINCR

Start

143280832

CPC Label

noncoding

End

143281929

Cancer

CCRC

Strand

-

Peptide

ALPSAAAK

Modified Peptide

n[230]ALPSAAAK

Peptide Length

8

ORF Length

101

Open Reading Frame (ORF)

LRRREGHTLSGLLPVFSSGFRSVWCPGRVSSELCCFAPARALPSAAAKTGARVPNFAEELHRPPARDLRPQPSTPRLGDLSPPSGPAHHESGPVLGAGMKQ

Conservation Score

0.304

PhyloCSF Frame 1

0

No. of Spectra

12

CPC Coding Probability

0.150069

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9923

PhyloCSF Frame 3

0

CNTI Score

-0.326387247