McDonnell Genome Institute

Washington University

Transcript

MID1IP1-AS1:7

Chromosome

chrX

Gene Name

MID1IP1-AS1

Start

38794158

CPC Label

noncoding

End

38803831

Cancer

OSCC

Strand

-

Peptide

NPVLGASK

Modified Peptide

n[145]NPVLGASK

Peptide Length

8

ORF Length

51

Open Reading Frame (ORF)

LHKNVCEPNLNGNRKVVSSPNFGPLGQKPLFLLSAPVNCSLRNPVLGASKL

Conservation Score

0.692

PhyloCSF Frame 1

-5.207

No. of Spectra

1

CPC Coding Probability

0.0997406

PhyloCSF Frame 2 

-5.62

CNTI Index

coding

Max Probability

0.7445

PhyloCSF Frame 3

-5.109

CNTI Score

0.606716875