McDonnell Genome Institute

Washington University

Transcript

MESTIT1:1

Chromosome

chr7

Gene Name

MESTIT1

Start

130487056

CPC Label

noncoding

End

130491172

Cancer

OSCC

Strand

-

Peptide

ERQGELLK

Modified Peptide

n[145]ERQGELLK

Peptide Length

8

ORF Length

49

Open Reading Frame (ORF)

MSTHMDQVGRLEEKQFKGPGGRRERQGELLKTTGIPSLALGRNPPFRHY

Conservation Score

0.746

PhyloCSF Frame 1

-3.986

No. of Spectra

1

CPC Coding Probability

0.0629567

PhyloCSF Frame 2 

-5.005

CNTI Index

noncoding

Max Probability

0.2538

PhyloCSF Frame 3

0

CNTI Score

-0.316044347