McDonnell Genome Institute

Washington University

Transcript

MEIS1-AS3:3

Chromosome

chr2

Gene Name

MEIS1-AS3

Start

66420813

CPC Label

noncoding

End

66434242

Cancer

OV

Strand

-

Peptide

NLPVPEK

Modified Peptide

n[145]NLPVPEK

Peptide Length

7

ORF Length

62

Open Reading Frame (ORF)

LPSPPQTSFPALLFPVPNPARRNLPVPEKKKSASEAEISDKSCLYLQLGGSNQPLFFVLFCF

Conservation Score

1

PhyloCSF Frame 1

-3.195

No. of Spectra

28

CPC Coding Probability

0.0887398

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9737

PhyloCSF Frame 3

0

CNTI Score

0.626646664