McDonnell Genome Institute

Washington University

Transcript

MEIS1-AS3:2

Chromosome

chr2

Gene Name

MEIS1-AS3

Start

66423342

CPC Label

noncoding

End

66433470

Cancer

OV

Strand

-

Peptide

APFSPAGLGDAGSPR

Modified Peptide

n[145]APFSPAGLGDAGSPR

Peptide Length

15

ORF Length

103

Open Reading Frame (ORF)

LRSYFSLWGSPQPVPEGVGSWSGLGSGGWQPGSRSRSARTRGLGRSDDGAPASVFCCFGAEHPRAPFSPAGLGDAGSPRHLPLGLILEASRLRSWTALPQGQQ

Conservation Score

0.879

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0849662

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5226

PhyloCSF Frame 3

0

CNTI Score

-0.332856839