McDonnell Genome Institute

Washington University

Transcript

MEG9:6

Chromosome

chr14

Gene Name

MEG9

Start

101064150

CPC Label

noncoding

End

101072937

Cancer

OV

Strand

+

Peptide

WLVQSWRPTELTVVR

Modified Peptide

n[145]WLVQSWRPTELTVVR

Peptide Length

15

ORF Length

68

Open Reading Frame (ORF)

LPPVQVHETRWLVQSWRPTELTVVRGPQGFREPPNVRAAPFLSCLSAHTLGQEEAHGRHSENVCGMNK

Conservation Score

0.92

PhyloCSF Frame 1

-4.648

No. of Spectra

1

CPC Coding Probability

0.130632

PhyloCSF Frame 2 

-4.646

CNTI Index

noncoding

Max Probability

0.7241

PhyloCSF Frame 3

-3.136

CNTI Score

-0.341103045