McDonnell Genome Institute

Washington University

Transcript

MEG9:1

Chromosome

chr14

Gene Name

MEG9

Start

101069910

CPC Label

noncoding

End

101072934

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

TPHSLAPR

Modified Peptide

n[145]TPHSLAPR

Peptide Length

8

ORF Length

96

Open Reading Frame (ORF)

MHQGLLLPAQSPLRTPHSLAPRRRGQSQLDSATAWGASTRLGPRRWDRQTAPCARQLACRVPRGQRPWSFLGQEAAEKVHRAWVQETIQNAASRHL

Conservation Score

1

PhyloCSF Frame 1

-3.872

No. of Spectra

16

CPC Coding Probability

0.0867359

PhyloCSF Frame 2 

-3.129

CNTI Index

noncoding

Max Probability

0.9972

PhyloCSF Frame 3

-2.843

CNTI Score

-0.309030096