McDonnell Genome Institute

Washington University

Transcript

MEF2C-AS1:25

Chromosome

chr5

Gene Name

MEF2C-AS1

Start

88883372

CPC Label

noncoding

End

88901350

Cancer

OSCC

Strand

+

Peptide

YLTFNGHILFVR

Modified Peptide

n[145]YLTFNGHILFVR

Peptide Length

12

ORF Length

42

Open Reading Frame (ORF)

LKYLTFNGHILFVRLCINCFINFCFLLFKEQPFRHVLLLSPF

Conservation Score

0.473

PhyloCSF Frame 1

-4.358

No. of Spectra

2

CPC Coding Probability

0.37455

PhyloCSF Frame 2 

-6.356

CNTI Index

coding

Max Probability

0.7468

PhyloCSF Frame 3

-5.381

CNTI Score

0.589857463