McDonnell Genome Institute

Washington University

Transcript

MBNL1-AS1:1

Chromosome

chr3

Gene Name

MBNL1-AS1

Start

152262615

CPC Label

noncoding

End

152269626

Cancer

PRAD

Strand

-

Peptide

LGGPTVDQVPK

Modified Peptide

Peptide Length

11

ORF Length

49

Open Reading Frame (ORF)

MAAPGPGMREPPGRPARRSTQRDSHLPPTKVIKLGGPTVDQVPKALWES

Conservation Score

1

PhyloCSF Frame 1

3.406

No. of Spectra

3

CPC Coding Probability

0.218948

PhyloCSF Frame 2 

-0.293

CNTI Index

noncoding

Max Probability

0.9946

PhyloCSF Frame 3

-1.675

CNTI Score

-0.27926206