McDonnell Genome Institute

Washington University

Transcript

MAPT-IT1:1

Chromosome

chr17

Gene Name

MAPT-IT1

Start

45895782

CPC Label

noncoding

End

45898798

Cancer

OSCC

Strand

+

Peptide

GEPAATATYCHLASR

Modified Peptide

n[145]GEPAATATYCHLASR

Peptide Length

15

ORF Length

108

Open Reading Frame (ORF)

LEPGYCEAPRMAGPAARGCRAAQGSIQASSLLPRPQTELGAGFPFQMERGSRGGPGKGEPAATATYCHLASRDVTSCLWRKGSPVGMSAFSPMLGTKRTPRFCDFAPF

Conservation Score

1

PhyloCSF Frame 1

-1.16

No. of Spectra

1

CPC Coding Probability

0.380987

PhyloCSF Frame 2 

-2.597

CNTI Index

noncoding

Max Probability

0.7713

PhyloCSF Frame 3

-3.059

CNTI Score

-0.318960661