McDonnell Genome Institute

Washington University

Transcript

MAPT-AS1:1

Chromosome

chr17

Gene Name

MAPT-AS1

Start

45799389

CPC Label

noncoding

End

45895630

Cancer

PRAD

Strand

-

Peptide

SLQASAGSSAQLGCSGPQNAPPLQR

Modified Peptide

SLQASAGSSAQLGCSGPQNAPPLQR

Peptide Length

25

ORF Length

146

Open Reading Frame (ORF)

LQFRSPGPTTTHLSPHASTDAQLGRVPRAPRGQGPHWPSAEPQLDSHPSTRSLALLLSPKAVLSLAVWLSVSHLTPLRLNILICEVGAMWSFLPTSLGDGPFVGNQETCICNIKSLQASAGSSAQLGCSGPQNAPPLQRAGLEQLS

Conservation Score

0.346

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.301491

PhyloCSF Frame 2 

-3.815

CNTI Index

noncoding

Max Probability

0.7667

PhyloCSF Frame 3

0

CNTI Score

-0.312860733