McDonnell Genome Institute

Washington University

Transcript

MAP3K20-AS1:22

Chromosome

chr2

Gene Name

MAP3K20-AS1

Start

173197711

CPC Label

noncoding

End

173282036

Cancer

OV

Strand

-

Peptide

LKCTSEQGRQQSGNAR

Modified Peptide

n[145]LKCTSEQGRQQSGNAR

Peptide Length

16

ORF Length

138

Open Reading Frame (ORF)

MKTKSSGIHWQNPTLNRYGGGSGFGSTFHFATRLKCTSEQGRQQSGNARHGESTLVTTGNTTNQVFCQETQIGTLITTLHGSFSAGCHRSTVTWLMKIQNRTNRMTHFLFLMLIAIIARSHSVAQAGVSWPDLGSMQL

Conservation Score

0.985

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.254053

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1485

PhyloCSF Frame 3

0

CNTI Score

-0.350652725