McDonnell Genome Institute

Washington University

Transcript

MAP3K20-AS1:17

Chromosome

chr2

Gene Name

MAP3K20-AS1

Start

173187619

CPC Label

noncoding

End

173282037

Cancer

HCC

Strand

-

Peptide

AVTVYNNYNQHTYIPNTNK

Modified Peptide

AVTVYNNYNQHTYIPNTNK

Peptide Length

19

ORF Length

132

Open Reading Frame (ORF)

LVLRLYFISGKAEGGISHQSPGNCKALKEGSIKFVFIYEIMLRLKVQCMYSCVLRSKIFEIRKFKHLGRILKVKALYVCGLISAKMNLKSLLVHINVTNNLKAVTVYNNYNQHTYIPNTNKHVYIHLYTHAH

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.207433

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0859

PhyloCSF Frame 3

0

CNTI Score

-0.350652725